PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi000276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 477aa    MW: 52601.9 Da    PI: 6.1448
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-5376PU_refplantGDBView CDS
gnl|UG|Psi#S50072192PU_unrefUnigeneView CDS
gnl|UG|Psi#S42998719PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-33246300155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kprlrWtpeLHe+Fvea+++LGG+e+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  Psi000276 246 KPRLRWTPELHENFVEAINKLGGAERATPKGVLKLMNVEGLTIYHVKSHLQKYRI 300
                79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-32243301IPR009057Homeodomain-like
PROSITE profilePS5129413.455243303IPR017930Myb domain
SuperFamilySSF466894.84E-18244300IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-25246301IPR006447Myb domain, plants
PfamPF002491.6E-9248299IPR001005SANT/Myb domain
PfamPF143792.2E-23330376IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MGTPHAFRAA PAPDTEHSWN ACFIENNVPP SQHILPQVLS PDSRQANSFR TVSPVSSVSN  60
AGIGHGHMYS SASSFCTSLH HSSSAGSQRQ NQLNGLPFLP QPSKTLLPGS AVRSSQSGLS  120
YSSEGRNLRC QEAGTEHPLQ ELFNFSEELS EYSQRSQEKP ANAQNVGQEQ SKQSDWPLWT  180
EHLVSDDLSD LLVGDPCINT AYQTAKSSAT ESTSHQLQSH QQFLPPSGGI HLPANSPASG  240
AGASNKPRLR WTPELHENFV EAINKLGGAE RATPKGVLKL MNVEGLTIYH VKSHLQKYRI  300
AKYISDYTDG NANRKRNVDD DISLDLKTGM QITEALRLQM EVQKQLHEQL ETQRNLQLRI  360
EEHGRYLQKM FEEQTKAGNL FKSHGPSAAG CSDPSPEETS SKLSKEESNA GHSEPNLDTS  420
EKENSVSEKL PVSRTYGDGQ QLAWDHHEST PDLEFQPESP LSKSKRIRLD GDIQDVD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.219920.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LPK90.0B8LPK9_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.19e-57phosphate starvation response 1